Placeholder image of a protein
Icon representing a puzzle

1887: Refinement Target: R1091

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
September 04, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SDPLTVPVEVEWQGVTGARTVITADQPSNVELKLVQKNKNGGSDNQDYRKTNVNVSKNVSNETRNFEKVAKGYQYDLIAPDVPAFTKEIKNVGTESNPSFKVIYKQL

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,108
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 11,047
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 11,032
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,988
  5. Avatar for Contenders 5. Contenders 16 pts. 10,950
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,865
  7. Avatar for Hold My Beer 7. Hold My Beer 5 pts. 10,736
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 10,728
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,499
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 10,262
  1. Avatar for spdenne 71. spdenne Lv 1 4 pts. 9,645
  2. Avatar for Pawel Tluscik 72. Pawel Tluscik Lv 1 4 pts. 9,619
  3. Avatar for hada 73. hada Lv 1 4 pts. 9,605
  4. Avatar for Jumper2 74. Jumper2 Lv 1 3 pts. 9,596
  5. Avatar for Hellcat6 75. Hellcat6 Lv 1 3 pts. 9,563
  6. Avatar for cbwest 76. cbwest Lv 1 3 pts. 9,516
  7. Avatar for BarrySampson 77. BarrySampson Lv 1 3 pts. 9,502
  8. Avatar for aendgraend 78. aendgraend Lv 1 3 pts. 9,440
  9. Avatar for The- Riviera-Kid 79. The- Riviera-Kid Lv 1 2 pts. 9,425
  10. Avatar for tracybutt 80. tracybutt Lv 1 2 pts. 9,421

Comments