Placeholder image of a protein
Icon representing a puzzle

1887: Refinement Target: R1091

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
September 04, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SDPLTVPVEVEWQGVTGARTVITADQPSNVELKLVQKNKNGGSDNQDYRKTNVNVSKNVSNETRNFEKVAKGYQYDLIAPDVPAFTKEIKNVGTESNPSFKVIYKQL

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,108
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 11,047
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 11,032
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,988
  5. Avatar for Contenders 5. Contenders 16 pts. 10,950
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,865
  7. Avatar for Hold My Beer 7. Hold My Beer 5 pts. 10,736
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 10,728
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,499
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 10,262
  1. Avatar for Tygh 31. Tygh Lv 1 31 pts. 10,717
  2. Avatar for jobo0502 32. jobo0502 Lv 1 30 pts. 10,618
  3. Avatar for Deleted player 33. Deleted player pts. 10,617
  4. Avatar for georg137 34. georg137 Lv 1 27 pts. 10,611
  5. Avatar for Alistair69 35. Alistair69 Lv 1 26 pts. 10,588
  6. Avatar for johnmitch 36. johnmitch Lv 1 25 pts. 10,569
  7. Avatar for dcrwheeler 37. dcrwheeler Lv 1 24 pts. 10,566
  8. Avatar for WBarme1234 38. WBarme1234 Lv 1 23 pts. 10,528
  9. Avatar for Mike Lewis 39. Mike Lewis Lv 1 22 pts. 10,511
  10. Avatar for TastyMunchies 40. TastyMunchies Lv 1 21 pts. 10,506

Comments