Placeholder image of a protein
Icon representing a puzzle

1887: Refinement Target: R1091

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
September 04, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SDPLTVPVEVEWQGVTGARTVITADQPSNVELKLVQKNKNGGSDNQDYRKTNVNVSKNVSNETRNFEKVAKGYQYDLIAPDVPAFTKEIKNVGTESNPSFKVIYKQL

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,108
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 11,047
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 11,032
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,988
  5. Avatar for Contenders 5. Contenders 16 pts. 10,950
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,865
  7. Avatar for Hold My Beer 7. Hold My Beer 5 pts. 10,736
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 10,728
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,499
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 10,262
  1. Avatar for fpc 41. fpc Lv 1 20 pts. 10,499
  2. Avatar for Deleted player 42. Deleted player 19 pts. 10,479
  3. Avatar for Jpilkington 43. Jpilkington Lv 1 18 pts. 10,448
  4. Avatar for Steven Pletsch 44. Steven Pletsch Lv 1 17 pts. 10,442
  5. Avatar for MrZanav 45. MrZanav Lv 1 16 pts. 10,413
  6. Avatar for KarenCH 46. KarenCH Lv 1 16 pts. 10,399
  7. Avatar for Blipperman 47. Blipperman Lv 1 15 pts. 10,391
  8. Avatar for infjamc 48. infjamc Lv 1 14 pts. 10,319
  9. Avatar for sgeldhof 49. sgeldhof Lv 1 13 pts. 10,298
  10. Avatar for CharlieFortsConscience 50. CharlieFortsConscience Lv 1 13 pts. 10,275

Comments