Placeholder image of a protein
Icon representing a puzzle

1919: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,848
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,837
  3. Avatar for Go Science 3. Go Science 54 pts. 9,743
  4. Avatar for Contenders 4. Contenders 38 pts. 9,697
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,694
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 9,676
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 9,667
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,605
  9. Avatar for Team China 9. Team China 5 pts. 9,303
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 9,295
  1. Avatar for Trajan464 91. Trajan464 Lv 1 2 pts. 9,229
  2. Avatar for CAN1958 92. CAN1958 Lv 1 2 pts. 9,220
  3. Avatar for pfirth 93. pfirth Lv 1 2 pts. 9,216
  4. Avatar for rinze 94. rinze Lv 1 2 pts. 9,213
  5. Avatar for zannipietro 95. zannipietro Lv 1 2 pts. 9,210
  6. Avatar for ProfVince 96. ProfVince Lv 1 2 pts. 9,207
  7. Avatar for JasperD 97. JasperD Lv 1 2 pts. 9,206
  8. Avatar for lsh5422 98. lsh5422 Lv 1 2 pts. 9,201
  9. Avatar for Hellcat6 99. Hellcat6 Lv 1 2 pts. 9,198
  10. Avatar for hada 100. hada Lv 1 2 pts. 9,197

Comments