Placeholder image of a protein
Icon representing a puzzle

1919: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,848
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,837
  3. Avatar for Go Science 3. Go Science 54 pts. 9,743
  4. Avatar for Contenders 4. Contenders 38 pts. 9,697
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,694
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 9,676
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 9,667
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,605
  9. Avatar for Team China 9. Team China 5 pts. 9,303
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 9,295
  1. Avatar for SaraL 101. SaraL Lv 1 1 pt. 9,195
  2. Avatar for RainBowFrog 102. RainBowFrog Lv 1 1 pt. 9,194
  3. Avatar for Arne Heessels 103. Arne Heessels Lv 1 1 pt. 9,194
  4. Avatar for fisherlr777 104. fisherlr777 Lv 1 1 pt. 9,180
  5. Avatar for kyoota 105. kyoota Lv 1 1 pt. 9,179
  6. Avatar for AlkiP0Ps 106. AlkiP0Ps Lv 1 1 pt. 9,179
  7. Avatar for Ashrai 107. Ashrai Lv 1 1 pt. 9,158
  8. Avatar for IvanBaner 108. IvanBaner Lv 1 1 pt. 9,156
  9. Avatar for Mohoernchen 109. Mohoernchen Lv 1 1 pt. 9,154
  10. Avatar for heyubob 110. heyubob Lv 1 1 pt. 9,145

Comments