Placeholder image of a protein
Icon representing a puzzle

1919: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,848
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,837
  3. Avatar for Go Science 3. Go Science 54 pts. 9,743
  4. Avatar for Contenders 4. Contenders 38 pts. 9,697
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,694
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 9,676
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 9,667
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,605
  9. Avatar for Team China 9. Team China 5 pts. 9,303
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 9,295
  1. Avatar for MrZanav 71. MrZanav Lv 1 7 pts. 9,345
  2. Avatar for jamiexq 72. jamiexq Lv 1 7 pts. 9,333
  3. Avatar for donuts554 73. donuts554 Lv 1 6 pts. 9,328
  4. Avatar for hansvandenhof 74. hansvandenhof Lv 1 6 pts. 9,320
  5. Avatar for diamonddays 75. diamonddays Lv 1 6 pts. 9,309
  6. Avatar for zo3xiaJonWeinberg 76. zo3xiaJonWeinberg Lv 1 5 pts. 9,303
  7. Avatar for Simek 77. Simek Lv 1 5 pts. 9,303
  8. Avatar for NPrincipi 78. NPrincipi Lv 1 5 pts. 9,295
  9. Avatar for SKSbell 79. SKSbell Lv 1 5 pts. 9,295
  10. Avatar for ShadowTactics 80. ShadowTactics Lv 1 4 pts. 9,295

Comments