Placeholder image of a protein
Icon representing a puzzle

1919: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,848
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,837
  3. Avatar for Go Science 3. Go Science 54 pts. 9,743
  4. Avatar for Contenders 4. Contenders 38 pts. 9,697
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,694
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 9,676
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 9,667
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,605
  9. Avatar for Team China 9. Team China 5 pts. 9,303
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 9,295
  1. Avatar for Deleted player 11. Deleted player 74 pts. 9,669
  2. Avatar for Phyx 12. Phyx Lv 1 71 pts. 9,668
  3. Avatar for fpc 13. fpc Lv 1 69 pts. 9,667
  4. Avatar for Tygh 14. Tygh Lv 1 67 pts. 9,662
  5. Avatar for 181818 15. 181818 Lv 1 65 pts. 9,661
  6. Avatar for guineapig 16. guineapig Lv 1 63 pts. 9,660
  7. Avatar for NinjaGreg 17. NinjaGreg Lv 1 61 pts. 9,659
  8. Avatar for Bruno Kestemont 18. Bruno Kestemont Lv 1 59 pts. 9,656
  9. Avatar for robgee 19. robgee Lv 1 57 pts. 9,654
  10. Avatar for Anfinsen_slept_here 20. Anfinsen_slept_here Lv 1 55 pts. 9,652

Comments