Placeholder image of a protein
Icon representing a puzzle

1919: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,848
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,837
  3. Avatar for Go Science 3. Go Science 54 pts. 9,743
  4. Avatar for Contenders 4. Contenders 38 pts. 9,697
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,694
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 9,676
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 9,667
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,605
  9. Avatar for Team China 9. Team China 5 pts. 9,303
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 9,295
  1. Avatar for John McLeod 41. John McLeod Lv 1 25 pts. 9,534
  2. Avatar for akaaka 42. akaaka Lv 1 24 pts. 9,530
  3. Avatar for BarrySampson 43. BarrySampson Lv 1 24 pts. 9,524
  4. Avatar for aznarog 44. aznarog Lv 1 23 pts. 9,521
  5. Avatar for Lotus23 45. Lotus23 Lv 1 22 pts. 9,518
  6. Avatar for GuR0 46. GuR0 Lv 1 21 pts. 9,514
  7. Avatar for Todd6485577 47. Todd6485577 Lv 1 20 pts. 9,498
  8. Avatar for jausmh 48. jausmh Lv 1 19 pts. 9,492
  9. Avatar for Jpilkington 49. Jpilkington Lv 1 18 pts. 9,492
  10. Avatar for Enzyme 50. Enzyme Lv 1 18 pts. 9,476

Comments