Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,602
  2. Avatar for Gargleblasters 2. Gargleblasters 71 pts. 11,587
  3. Avatar for Go Science 3. Go Science 49 pts. 11,584
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 11,528
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,416
  6. Avatar for Contenders 6. Contenders 14 pts. 11,275
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,203
  8. Avatar for Russian team 8. Russian team 5 pts. 11,095
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 3 pts. 10,886
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,854
  1. Avatar for RockOn 141. RockOn Lv 1 1 pt. 10,153
  2. Avatar for p34t 142. p34t Lv 1 1 pt. 10,131
  3. Avatar for Clement Wong 143. Clement Wong Lv 1 1 pt. 10,060
  4. Avatar for Formula350 144. Formula350 Lv 1 1 pt. 10,051
  5. Avatar for rebekkahsch 145. rebekkahsch Lv 1 1 pt. 10,042
  6. Avatar for winterkonig 146. winterkonig Lv 1 1 pt. 9,867
  7. Avatar for Shad Amethyst 147. Shad Amethyst Lv 1 1 pt. 9,815
  8. Avatar for mei190000 148. mei190000 Lv 1 1 pt. 9,796
  9. Avatar for devjosh 149. devjosh Lv 1 1 pt. 9,727
  10. Avatar for Irwin1985 150. Irwin1985 Lv 1 1 pt. 9,682

Comments