Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,602
  2. Avatar for Gargleblasters 2. Gargleblasters 71 pts. 11,587
  3. Avatar for Go Science 3. Go Science 49 pts. 11,584
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 11,528
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,416
  6. Avatar for Contenders 6. Contenders 14 pts. 11,275
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,203
  8. Avatar for Russian team 8. Russian team 5 pts. 11,095
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 3 pts. 10,886
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,854
  1. Avatar for Korosi 131. Korosi Lv 1 1 pt. 10,212
  2. Avatar for illex 132. illex Lv 1 1 pt. 10,203
  3. Avatar for kludbrook 133. kludbrook Lv 1 1 pt. 10,201
  4. Avatar for Sammy3c2b1a0 134. Sammy3c2b1a0 Lv 1 1 pt. 10,199
  5. Avatar for fisherlr777 135. fisherlr777 Lv 1 1 pt. 10,188
  6. Avatar for bkoep 136. bkoep Lv 1 1 pt. 10,180
  7. Avatar for raibaa 137. raibaa Lv 1 1 pt. 10,178
  8. Avatar for User098123 138. User098123 Lv 1 1 pt. 10,177
  9. Avatar for Ibragimov Rashid Aydamirovich 139. Ibragimov Rashid Aydamirovich Lv 1 1 pt. 10,177
  10. Avatar for helpau_foldit 140. helpau_foldit Lv 1 1 pt. 10,171

Comments