Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,602
  2. Avatar for Gargleblasters 2. Gargleblasters 71 pts. 11,587
  3. Avatar for Go Science 3. Go Science 49 pts. 11,584
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 11,528
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,416
  6. Avatar for Contenders 6. Contenders 14 pts. 11,275
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,203
  8. Avatar for Russian team 8. Russian team 5 pts. 11,095
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 3 pts. 10,886
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,854
  1. Avatar for Deet 111. Deet Lv 1 1 pt. 10,353
  2. Avatar for Beany 112. Beany Lv 1 1 pt. 10,350
  3. Avatar for Baddi86 113. Baddi86 Lv 1 1 pt. 10,338
  4. Avatar for pruneau_44 114. pruneau_44 Lv 1 1 pt. 10,333
  5. Avatar for Dr.Sillem 115. Dr.Sillem Lv 1 1 pt. 10,315
  6. Avatar for AlkiP0Ps 116. AlkiP0Ps Lv 1 1 pt. 10,308
  7. Avatar for GMTmaster 117. GMTmaster Lv 1 1 pt. 10,300
  8. Avatar for foldit109ljsd 118. foldit109ljsd Lv 1 1 pt. 10,295
  9. Avatar for pascal ochem 119. pascal ochem Lv 1 1 pt. 10,286
  10. Avatar for wiktorianna15 120. wiktorianna15 Lv 1 1 pt. 10,285

Comments