Placeholder image of a protein
Icon representing a puzzle

1946: Revisiting Puzzle 52: Bacteria Energy

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 20, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,576
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 11,561
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 11,440
  4. Avatar for Go Science 4. Go Science 38 pts. 11,436
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,341
  6. Avatar for Contenders 6. Contenders 18 pts. 11,188
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,933
  8. Avatar for Olsztynek 8. Olsztynek 8 pts. 10,872
  9. Avatar for Team China 9. Team China 5 pts. 10,629
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 10,600
  1. Avatar for infjamc 41. infjamc Lv 1 19 pts. 10,876
  2. Avatar for Pawel Tluscik 42. Pawel Tluscik Lv 1 18 pts. 10,872
  3. Avatar for georg137 43. georg137 Lv 1 17 pts. 10,871
  4. Avatar for cjddig 44. cjddig Lv 1 16 pts. 10,864
  5. Avatar for pauldunn 45. pauldunn Lv 1 15 pts. 10,856
  6. Avatar for SKSbell 46. SKSbell Lv 1 15 pts. 10,836
  7. Avatar for Norrjane 47. Norrjane Lv 1 14 pts. 10,804
  8. Avatar for GuR0 48. GuR0 Lv 1 13 pts. 10,797
  9. Avatar for Lotus23 49. Lotus23 Lv 1 13 pts. 10,793
  10. Avatar for Formula350 50. Formula350 Lv 1 12 pts. 10,780

Comments