Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 9,590
  2. Avatar for Olsztynek 12. Olsztynek 1 pt. 9,316
  3. Avatar for Australia 13. Australia 1 pt. 8,909
  4. Avatar for Biotechnology-105 (2020) 14. Biotechnology-105 (2020) 1 pt. 8,593
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 2,942
  1. Avatar for pascal ochem 111. pascal ochem Lv 1 1 pt. 8,726
  2. Avatar for Silver_Fire 112. Silver_Fire Lv 1 1 pt. 8,717
  3. Avatar for Randolph_M_Snyder 113. Randolph_M_Snyder Lv 1 1 pt. 8,644
  4. Avatar for InariInari2020 114. InariInari2020 Lv 1 1 pt. 8,623
  5. Avatar for Yann1ck2000 115. Yann1ck2000 Lv 1 1 pt. 8,621
  6. Avatar for komrad7 116. komrad7 Lv 1 1 pt. 8,593
  7. Avatar for roman madala 117. roman madala Lv 1 1 pt. 8,587
  8. Avatar for reubes1 118. reubes1 Lv 1 1 pt. 8,585
  9. Avatar for rthompson1 119. rthompson1 Lv 1 1 pt. 8,583
  10. Avatar for alross8991 120. alross8991 Lv 1 1 pt. 8,565

Comments