Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,136
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,134
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,016
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 10,010
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,003
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,888
  7. Avatar for Italiani Al Lavoro 7. Italiani Al Lavoro 8 pts. 9,798
  8. Avatar for Contenders 8. Contenders 5 pts. 9,730
  9. Avatar for Team China 9. Team China 3 pts. 9,657
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,656
  1. Avatar for pascal ochem 111. pascal ochem Lv 1 1 pt. 8,726
  2. Avatar for Silver_Fire 112. Silver_Fire Lv 1 1 pt. 8,717
  3. Avatar for Randolph_M_Snyder 113. Randolph_M_Snyder Lv 1 1 pt. 8,644
  4. Avatar for InariInari2020 114. InariInari2020 Lv 1 1 pt. 8,623
  5. Avatar for Yann1ck2000 115. Yann1ck2000 Lv 1 1 pt. 8,621
  6. Avatar for komrad7 116. komrad7 Lv 1 1 pt. 8,593
  7. Avatar for roman madala 117. roman madala Lv 1 1 pt. 8,587
  8. Avatar for reubes1 118. reubes1 Lv 1 1 pt. 8,585
  9. Avatar for rthompson1 119. rthompson1 Lv 1 1 pt. 8,583
  10. Avatar for alross8991 120. alross8991 Lv 1 1 pt. 8,565

Comments