Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 9,590
  2. Avatar for Olsztynek 12. Olsztynek 1 pt. 9,316
  3. Avatar for Australia 13. Australia 1 pt. 8,909
  4. Avatar for Biotechnology-105 (2020) 14. Biotechnology-105 (2020) 1 pt. 8,593
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 2,942
  1. Avatar for xythus 31. xythus Lv 1 33 pts. 9,862
  2. Avatar for blazegeek 32. blazegeek Lv 1 31 pts. 9,851
  3. Avatar for equilibria 33. equilibria Lv 1 30 pts. 9,841
  4. Avatar for APPAAP 34. APPAAP Lv 1 29 pts. 9,830
  5. Avatar for manu8170 35. manu8170 Lv 1 28 pts. 9,828
  6. Avatar for johnmitch 36. johnmitch Lv 1 26 pts. 9,799
  7. Avatar for vuvuvu 37. vuvuvu Lv 1 25 pts. 9,798
  8. Avatar for Deleted player 38. Deleted player 24 pts. 9,787
  9. Avatar for WBarme1234 39. WBarme1234 Lv 1 23 pts. 9,763
  10. Avatar for BarrySampson 40. BarrySampson Lv 1 22 pts. 9,755

Comments