Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,136
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,134
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,016
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 10,010
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,003
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,888
  7. Avatar for Italiani Al Lavoro 7. Italiani Al Lavoro 8 pts. 9,798
  8. Avatar for Contenders 8. Contenders 5 pts. 9,730
  9. Avatar for Team China 9. Team China 3 pts. 9,657
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,656
  1. Avatar for xythus 31. xythus Lv 1 33 pts. 9,862
  2. Avatar for blazegeek 32. blazegeek Lv 1 31 pts. 9,851
  3. Avatar for equilibria 33. equilibria Lv 1 30 pts. 9,841
  4. Avatar for APPAAP 34. APPAAP Lv 1 29 pts. 9,830
  5. Avatar for manu8170 35. manu8170 Lv 1 28 pts. 9,828
  6. Avatar for johnmitch 36. johnmitch Lv 1 26 pts. 9,799
  7. Avatar for vuvuvu 37. vuvuvu Lv 1 25 pts. 9,798
  8. Avatar for Deleted player 38. Deleted player 24 pts. 9,787
  9. Avatar for WBarme1234 39. WBarme1234 Lv 1 23 pts. 9,763
  10. Avatar for BarrySampson 40. BarrySampson Lv 1 22 pts. 9,755

Comments