Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 9,590
  2. Avatar for Olsztynek 12. Olsztynek 1 pt. 9,316
  3. Avatar for Australia 13. Australia 1 pt. 8,909
  4. Avatar for Biotechnology-105 (2020) 14. Biotechnology-105 (2020) 1 pt. 8,593
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 2,942
  1. Avatar for infjamc 41. infjamc Lv 1 21 pts. 9,730
  2. Avatar for REDing 42. REDing Lv 1 20 pts. 9,657
  3. Avatar for BootsMcGraw 43. BootsMcGraw Lv 1 19 pts. 9,656
  4. Avatar for ShadowTactics 44. ShadowTactics Lv 1 18 pts. 9,656
  5. Avatar for Vinara 45. Vinara Lv 1 18 pts. 9,628
  6. Avatar for fpc 46. fpc Lv 1 17 pts. 9,617
  7. Avatar for vybi 47. vybi Lv 1 16 pts. 9,590
  8. Avatar for drumpeter18yrs9yrs 48. drumpeter18yrs9yrs Lv 1 15 pts. 9,554
  9. Avatar for hada 49. hada Lv 1 15 pts. 9,537
  10. Avatar for ProfVince 50. ProfVince Lv 1 14 pts. 9,523

Comments