Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,136
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,134
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,016
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 10,010
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,003
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,888
  7. Avatar for Italiani Al Lavoro 7. Italiani Al Lavoro 8 pts. 9,798
  8. Avatar for Contenders 8. Contenders 5 pts. 9,730
  9. Avatar for Team China 9. Team China 3 pts. 9,657
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,656
  1. Avatar for infjamc 41. infjamc Lv 1 21 pts. 9,730
  2. Avatar for REDing 42. REDing Lv 1 20 pts. 9,657
  3. Avatar for BootsMcGraw 43. BootsMcGraw Lv 1 19 pts. 9,656
  4. Avatar for ShadowTactics 44. ShadowTactics Lv 1 18 pts. 9,656
  5. Avatar for Vinara 45. Vinara Lv 1 18 pts. 9,628
  6. Avatar for fpc 46. fpc Lv 1 17 pts. 9,617
  7. Avatar for vybi 47. vybi Lv 1 16 pts. 9,590
  8. Avatar for drumpeter18yrs9yrs 48. drumpeter18yrs9yrs Lv 1 15 pts. 9,554
  9. Avatar for hada 49. hada Lv 1 15 pts. 9,537
  10. Avatar for ProfVince 50. ProfVince Lv 1 14 pts. 9,523

Comments