Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 9,590
  2. Avatar for Olsztynek 12. Olsztynek 1 pt. 9,316
  3. Avatar for Australia 13. Australia 1 pt. 8,909
  4. Avatar for Biotechnology-105 (2020) 14. Biotechnology-105 (2020) 1 pt. 8,593
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 2,942
  1. Avatar for OWM3 51. OWM3 Lv 1 13 pts. 9,508
  2. Avatar for alcor29 52. alcor29 Lv 1 13 pts. 9,499
  3. Avatar for cjddig 53. cjddig Lv 1 12 pts. 9,495
  4. Avatar for heather-1 54. heather-1 Lv 1 11 pts. 9,491
  5. Avatar for toshiue 55. toshiue Lv 1 11 pts. 9,488
  6. Avatar for Hellcat6 56. Hellcat6 Lv 1 10 pts. 9,487
  7. Avatar for pizpot 57. pizpot Lv 1 10 pts. 9,470
  8. Avatar for argyrw 58. argyrw Lv 1 9 pts. 9,467
  9. Avatar for kyoota 59. kyoota Lv 1 9 pts. 9,439
  10. Avatar for rezaefar 60. rezaefar Lv 1 8 pts. 9,437

Comments