Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,136
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,134
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,016
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 10,010
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,003
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,888
  7. Avatar for Italiani Al Lavoro 7. Italiani Al Lavoro 8 pts. 9,798
  8. Avatar for Contenders 8. Contenders 5 pts. 9,730
  9. Avatar for Team China 9. Team China 3 pts. 9,657
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,656
  1. Avatar for OWM3 51. OWM3 Lv 1 13 pts. 9,508
  2. Avatar for alcor29 52. alcor29 Lv 1 13 pts. 9,499
  3. Avatar for cjddig 53. cjddig Lv 1 12 pts. 9,495
  4. Avatar for heather-1 54. heather-1 Lv 1 11 pts. 9,491
  5. Avatar for toshiue 55. toshiue Lv 1 11 pts. 9,488
  6. Avatar for Hellcat6 56. Hellcat6 Lv 1 10 pts. 9,487
  7. Avatar for pizpot 57. pizpot Lv 1 10 pts. 9,470
  8. Avatar for argyrw 58. argyrw Lv 1 9 pts. 9,467
  9. Avatar for kyoota 59. kyoota Lv 1 9 pts. 9,439
  10. Avatar for rezaefar 60. rezaefar Lv 1 8 pts. 9,437

Comments