Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 9,590
  2. Avatar for Olsztynek 12. Olsztynek 1 pt. 9,316
  3. Avatar for Australia 13. Australia 1 pt. 8,909
  4. Avatar for Biotechnology-105 (2020) 14. Biotechnology-105 (2020) 1 pt. 8,593
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 2,942
  1. Avatar for martinzblavy 61. martinzblavy Lv 1 8 pts. 9,426
  2. Avatar for Arne Heessels 62. Arne Heessels Lv 1 8 pts. 9,406
  3. Avatar for mrhastyrib 63. mrhastyrib Lv 1 7 pts. 9,383
  4. Avatar for NPrincipi 64. NPrincipi Lv 1 7 pts. 9,373
  5. Avatar for drjr 65. drjr Lv 1 6 pts. 9,371
  6. Avatar for sciencewalker 66. sciencewalker Lv 1 6 pts. 9,361
  7. Avatar for Pawel Tluscik 67. Pawel Tluscik Lv 1 6 pts. 9,316
  8. Avatar for maithra 68. maithra Lv 1 5 pts. 9,308
  9. Avatar for dahast.de 69. dahast.de Lv 1 5 pts. 9,294
  10. Avatar for tracybutt 70. tracybutt Lv 1 5 pts. 9,274

Comments