Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,136
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,134
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,016
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 10,010
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,003
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,888
  7. Avatar for Italiani Al Lavoro 7. Italiani Al Lavoro 8 pts. 9,798
  8. Avatar for Contenders 8. Contenders 5 pts. 9,730
  9. Avatar for Team China 9. Team China 3 pts. 9,657
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,656
  1. Avatar for martinzblavy 61. martinzblavy Lv 1 8 pts. 9,426
  2. Avatar for Arne Heessels 62. Arne Heessels Lv 1 8 pts. 9,406
  3. Avatar for mrhastyrib 63. mrhastyrib Lv 1 7 pts. 9,383
  4. Avatar for NPrincipi 64. NPrincipi Lv 1 7 pts. 9,373
  5. Avatar for drjr 65. drjr Lv 1 6 pts. 9,371
  6. Avatar for sciencewalker 66. sciencewalker Lv 1 6 pts. 9,361
  7. Avatar for Pawel Tluscik 67. Pawel Tluscik Lv 1 6 pts. 9,316
  8. Avatar for maithra 68. maithra Lv 1 5 pts. 9,308
  9. Avatar for dahast.de 69. dahast.de Lv 1 5 pts. 9,294
  10. Avatar for tracybutt 70. tracybutt Lv 1 5 pts. 9,274

Comments