Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 9,590
  2. Avatar for Olsztynek 12. Olsztynek 1 pt. 9,316
  3. Avatar for Australia 13. Australia 1 pt. 8,909
  4. Avatar for Biotechnology-105 (2020) 14. Biotechnology-105 (2020) 1 pt. 8,593
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 2,942
  1. Avatar for fearjuan 71. fearjuan Lv 1 5 pts. 9,257
  2. Avatar for Jpilkington 72. Jpilkington Lv 1 4 pts. 9,241
  3. Avatar for phi16 73. phi16 Lv 1 4 pts. 9,225
  4. Avatar for Todd6485577 74. Todd6485577 Lv 1 4 pts. 9,221
  5. Avatar for zo3xiaJonWeinberg 75. zo3xiaJonWeinberg Lv 1 4 pts. 9,216
  6. Avatar for joremen 76. joremen Lv 1 3 pts. 9,201
  7. Avatar for rabamino12358 77. rabamino12358 Lv 1 3 pts. 9,171
  8. Avatar for D4ng 78. D4ng Lv 1 3 pts. 9,161
  9. Avatar for Oransche 79. Oransche Lv 1 3 pts. 9,153
  10. Avatar for jsfoldingaccount 80. jsfoldingaccount Lv 1 3 pts. 9,149

Comments