Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,136
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,134
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,016
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 10,010
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,003
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,888
  7. Avatar for Italiani Al Lavoro 7. Italiani Al Lavoro 8 pts. 9,798
  8. Avatar for Contenders 8. Contenders 5 pts. 9,730
  9. Avatar for Team China 9. Team China 3 pts. 9,657
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,656
  1. Avatar for fearjuan 71. fearjuan Lv 1 5 pts. 9,257
  2. Avatar for Jpilkington 72. Jpilkington Lv 1 4 pts. 9,241
  3. Avatar for phi16 73. phi16 Lv 1 4 pts. 9,225
  4. Avatar for Todd6485577 74. Todd6485577 Lv 1 4 pts. 9,221
  5. Avatar for zo3xiaJonWeinberg 75. zo3xiaJonWeinberg Lv 1 4 pts. 9,216
  6. Avatar for joremen 76. joremen Lv 1 3 pts. 9,201
  7. Avatar for rabamino12358 77. rabamino12358 Lv 1 3 pts. 9,171
  8. Avatar for D4ng 78. D4ng Lv 1 3 pts. 9,161
  9. Avatar for Oransche 79. Oransche Lv 1 3 pts. 9,153
  10. Avatar for jsfoldingaccount 80. jsfoldingaccount Lv 1 3 pts. 9,149

Comments