Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 9,590
  2. Avatar for Olsztynek 12. Olsztynek 1 pt. 9,316
  3. Avatar for Australia 13. Australia 1 pt. 8,909
  4. Avatar for Window Group 15. Window Group 1 pt. 7,774
  5. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 2,942

  1. Avatar for Altercomp 81. Altercomp Lv 1 3 pts. 9,147
  2. Avatar for wosser1 82. wosser1 Lv 1 2 pts. 9,140
  3. Avatar for Evica 83. Evica Lv 1 2 pts. 9,121
  4. Avatar for georg137 84. georg137 Lv 1 2 pts. 9,119
  5. Avatar for Beany 85. Beany Lv 1 2 pts. 9,076
  6. Avatar for stomjoh 86. stomjoh Lv 1 2 pts. 9,076
  7. Avatar for fishercat 87. fishercat Lv 1 2 pts. 9,062
  8. Avatar for ultrawaffle 88. ultrawaffle Lv 1 2 pts. 9,014
  9. Avatar for pfirth 89. pfirth Lv 1 2 pts. 9,010
  10. Avatar for ManVsYard 90. ManVsYard Lv 1 2 pts. 8,999

Comments