Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,136
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,134
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,016
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 10,010
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,003
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,888
  7. Avatar for Italiani Al Lavoro 7. Italiani Al Lavoro 8 pts. 9,798
  8. Avatar for Contenders 8. Contenders 5 pts. 9,730
  9. Avatar for Team China 9. Team China 3 pts. 9,657
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,656
  1. Avatar for Altercomp 81. Altercomp Lv 1 3 pts. 9,147
  2. Avatar for wosser1 82. wosser1 Lv 1 2 pts. 9,140
  3. Avatar for Evica 83. Evica Lv 1 2 pts. 9,121
  4. Avatar for georg137 84. georg137 Lv 1 2 pts. 9,119
  5. Avatar for Beany 85. Beany Lv 1 2 pts. 9,076
  6. Avatar for stomjoh 86. stomjoh Lv 1 2 pts. 9,076
  7. Avatar for fishercat 87. fishercat Lv 1 2 pts. 9,062
  8. Avatar for ultrawaffle 88. ultrawaffle Lv 1 2 pts. 9,014
  9. Avatar for pfirth 89. pfirth Lv 1 2 pts. 9,010
  10. Avatar for ManVsYard 90. ManVsYard Lv 1 2 pts. 8,999

Comments