Placeholder image of a protein
Icon representing a puzzle

2004: Revisiting Puzzle 67: Integrase

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
June 10, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 9,969
  2. Avatar for Void Crushers 12. Void Crushers 2 pts. 9,966
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,622
  4. Avatar for Australia 14. Australia 1 pt. 9,542
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,512
  6. Avatar for Team China 16. Team China 1 pt. 9,501
  7. Avatar for Window Group 17. Window Group 1 pt. 3,439
  8. Avatar for BIOB101 - Discover Biology 18. BIOB101 - Discover Biology 1 pt. 3,092
  9. Avatar for incognito group 19. incognito group 1 pt. 2,966
  10. Avatar for Foldit Staff 20. Foldit Staff 1 pt. 2,966
  1. Avatar for alcor29 31. alcor29 Lv 1 31 pts. 10,230
  2. Avatar for Threeoak 32. Threeoak Lv 1 29 pts. 10,219
  3. Avatar for Norrjane 33. Norrjane Lv 1 28 pts. 10,193
  4. Avatar for manu8170 34. manu8170 Lv 1 27 pts. 10,183
  5. Avatar for xythus 35. xythus Lv 1 26 pts. 10,180
  6. Avatar for borattt 36. borattt Lv 1 25 pts. 10,179
  7. Avatar for NeLikomSheet 37. NeLikomSheet Lv 1 23 pts. 10,178
  8. Avatar for fiendish_ghoul 38. fiendish_ghoul Lv 1 22 pts. 10,169
  9. Avatar for MirsadaH 39. MirsadaH Lv 1 21 pts. 10,163
  10. Avatar for vybi 40. vybi Lv 1 20 pts. 10,136

Comments