Placeholder image of a protein
Icon representing a puzzle

2004: Revisiting Puzzle 67: Integrase

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
June 10, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,529
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,503
  3. Avatar for Contenders 3. Contenders 58 pts. 10,456
  4. Avatar for Go Science 4. Go Science 43 pts. 10,441
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 10,373
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 10,335
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 10,330
  8. Avatar for Czech National Team 8. Czech National Team 11 pts. 10,136
  9. Avatar for METU-BIN 9. METU-BIN 7 pts. 10,078
  10. Avatar for BOINC@Poland 10. BOINC@Poland 5 pts. 10,072
  1. Avatar for alcor29 31. alcor29 Lv 1 31 pts. 10,230
  2. Avatar for Threeoak 32. Threeoak Lv 1 29 pts. 10,219
  3. Avatar for Norrjane 33. Norrjane Lv 1 28 pts. 10,193
  4. Avatar for manu8170 34. manu8170 Lv 1 27 pts. 10,183
  5. Avatar for xythus 35. xythus Lv 1 26 pts. 10,180
  6. Avatar for borattt 36. borattt Lv 1 25 pts. 10,179
  7. Avatar for NeLikomSheet 37. NeLikomSheet Lv 1 23 pts. 10,178
  8. Avatar for fiendish_ghoul 38. fiendish_ghoul Lv 1 22 pts. 10,169
  9. Avatar for MirsadaH 39. MirsadaH Lv 1 21 pts. 10,163
  10. Avatar for vybi 40. vybi Lv 1 20 pts. 10,136

Comments