Placeholder image of a protein
Icon representing a puzzle

2004: Revisiting Puzzle 67: Integrase

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
June 10, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 9,969
  2. Avatar for Void Crushers 12. Void Crushers 2 pts. 9,966
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,622
  4. Avatar for Australia 14. Australia 1 pt. 9,542
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,512
  6. Avatar for Team China 16. Team China 1 pt. 9,501
  7. Avatar for Window Group 17. Window Group 1 pt. 3,439
  8. Avatar for BIOB101 - Discover Biology 18. BIOB101 - Discover Biology 1 pt. 3,092
  9. Avatar for incognito group 19. incognito group 1 pt. 2,966
  10. Avatar for Foldit Staff 20. Foldit Staff 1 pt. 2,966
  1. Avatar for ShadowTactics 51. ShadowTactics Lv 1 12 pts. 10,072
  2. Avatar for blazegeek 52. blazegeek Lv 1 11 pts. 10,064
  3. Avatar for NeedMoreCoffee 53. NeedMoreCoffee Lv 1 11 pts. 10,052
  4. Avatar for phi16 54. phi16 Lv 1 10 pts. 10,047
  5. Avatar for abiogenesis 55. abiogenesis Lv 1 9 pts. 10,034
  6. Avatar for AeonFluff 56. AeonFluff Lv 1 9 pts. 10,028
  7. Avatar for georg137 57. georg137 Lv 1 8 pts. 10,017
  8. Avatar for fpc 58. fpc Lv 1 8 pts. 10,003
  9. Avatar for Wiz kid 59. Wiz kid Lv 1 8 pts. 10,002
  10. Avatar for Pazithi 60. Pazithi Lv 1 7 pts. 10,000

Comments