Placeholder image of a protein
Icon representing a puzzle

2004: Revisiting Puzzle 67: Integrase

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
June 10, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,529
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,503
  3. Avatar for Contenders 3. Contenders 58 pts. 10,456
  4. Avatar for Go Science 4. Go Science 43 pts. 10,441
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 10,373
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 10,335
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 10,330
  8. Avatar for Czech National Team 8. Czech National Team 11 pts. 10,136
  9. Avatar for METU-BIN 9. METU-BIN 7 pts. 10,078
  10. Avatar for BOINC@Poland 10. BOINC@Poland 5 pts. 10,072
  1. Avatar for ShadowTactics 51. ShadowTactics Lv 1 12 pts. 10,072
  2. Avatar for blazegeek 52. blazegeek Lv 1 11 pts. 10,064
  3. Avatar for NeedMoreCoffee 53. NeedMoreCoffee Lv 1 11 pts. 10,052
  4. Avatar for phi16 54. phi16 Lv 1 10 pts. 10,047
  5. Avatar for abiogenesis 55. abiogenesis Lv 1 9 pts. 10,034
  6. Avatar for AeonFluff 56. AeonFluff Lv 1 9 pts. 10,028
  7. Avatar for georg137 57. georg137 Lv 1 8 pts. 10,017
  8. Avatar for fpc 58. fpc Lv 1 8 pts. 10,003
  9. Avatar for Wiz kid 59. Wiz kid Lv 1 8 pts. 10,002
  10. Avatar for Pazithi 60. Pazithi Lv 1 7 pts. 10,000

Comments