Placeholder image of a protein
Icon representing a puzzle

2004: Revisiting Puzzle 67: Integrase

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
June 10, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 9,969
  2. Avatar for Void Crushers 12. Void Crushers 2 pts. 9,966
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,622
  4. Avatar for Australia 14. Australia 1 pt. 9,542
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,512
  6. Avatar for Team China 16. Team China 1 pt. 9,501
  7. Avatar for Window Group 17. Window Group 1 pt. 3,439
  8. Avatar for BIOB101 - Discover Biology 18. BIOB101 - Discover Biology 1 pt. 3,092
  9. Avatar for incognito group 19. incognito group 1 pt. 2,966
  10. Avatar for Foldit Staff 20. Foldit Staff 1 pt. 2,966
  1. Avatar for Anfinsen_slept_here 61. Anfinsen_slept_here Lv 1 7 pts. 9,998
  2. Avatar for hada 62. hada Lv 1 6 pts. 9,995
  3. Avatar for infjamc 63. infjamc Lv 1 6 pts. 9,978
  4. Avatar for zippyc137 64. zippyc137 Lv 1 6 pts. 9,973
  5. Avatar for kyoota 65. kyoota Lv 1 5 pts. 9,973
  6. Avatar for Vinara 66. Vinara Lv 1 5 pts. 9,970
  7. Avatar for vuvuvu 67. vuvuvu Lv 1 5 pts. 9,969
  8. Avatar for Simek 68. Simek Lv 1 4 pts. 9,966
  9. Avatar for tracybutt 69. tracybutt Lv 1 4 pts. 9,949
  10. Avatar for Matroch 70. Matroch Lv 1 4 pts. 9,925

Comments