Placeholder image of a protein
Icon representing a puzzle

2004: Revisiting Puzzle 67: Integrase

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
June 10, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,529
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,503
  3. Avatar for Contenders 3. Contenders 58 pts. 10,456
  4. Avatar for Go Science 4. Go Science 43 pts. 10,441
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 10,373
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 10,335
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 10,330
  8. Avatar for Czech National Team 8. Czech National Team 11 pts. 10,136
  9. Avatar for METU-BIN 9. METU-BIN 7 pts. 10,078
  10. Avatar for BOINC@Poland 10. BOINC@Poland 5 pts. 10,072
  1. Avatar for Anfinsen_slept_here 61. Anfinsen_slept_here Lv 1 7 pts. 9,998
  2. Avatar for hada 62. hada Lv 1 6 pts. 9,995
  3. Avatar for infjamc 63. infjamc Lv 1 6 pts. 9,978
  4. Avatar for zippyc137 64. zippyc137 Lv 1 6 pts. 9,973
  5. Avatar for kyoota 65. kyoota Lv 1 5 pts. 9,973
  6. Avatar for Vinara 66. Vinara Lv 1 5 pts. 9,970
  7. Avatar for vuvuvu 67. vuvuvu Lv 1 5 pts. 9,969
  8. Avatar for Simek 68. Simek Lv 1 4 pts. 9,966
  9. Avatar for tracybutt 69. tracybutt Lv 1 4 pts. 9,949
  10. Avatar for Matroch 70. Matroch Lv 1 4 pts. 9,925

Comments