Placeholder image of a protein
Icon representing a puzzle

2004: Revisiting Puzzle 67: Integrase

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
June 10, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,529
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,503
  3. Avatar for Contenders 3. Contenders 58 pts. 10,456
  4. Avatar for Go Science 4. Go Science 43 pts. 10,441
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 10,373
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 10,335
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 10,330
  8. Avatar for Czech National Team 8. Czech National Team 11 pts. 10,136
  9. Avatar for METU-BIN 9. METU-BIN 7 pts. 10,078
  10. Avatar for BOINC@Poland 10. BOINC@Poland 5 pts. 10,072

  1. Avatar for buggo 131. buggo Lv 1 1 pt. 5,834
  2. Avatar for jflat06 132. jflat06 Lv 1 1 pt. 3,439
  3. Avatar for WelchW 133. WelchW Lv 1 1 pt. 3,092
  4. Avatar for despotzz 134. despotzz Lv 1 1 pt. 2,988
  5. Avatar for Draufi 135. Draufi Lv 1 1 pt. 2,977
  6. Avatar for yongchan 136. yongchan Lv 1 1 pt. 2,966
  7. Avatar for Belle36 137. Belle36 Lv 1 1 pt. 2,966
  8. Avatar for _MatiX_ 138. _MatiX_ Lv 1 1 pt. 2,966
  9. Avatar for 2027168878 139. 2027168878 Lv 1 1 pt. 2,966
  10. Avatar for ingoneato 140. ingoneato Lv 1 1 pt. 2,966

Comments