Placeholder image of a protein
Icon representing a puzzle

2004: Revisiting Puzzle 67: Integrase

Closed since almost 5 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 10, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,529
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,503
  3. Avatar for Contenders 3. Contenders 58 pts. 10,456
  4. Avatar for Go Science 4. Go Science 43 pts. 10,441
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 10,373
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 10,335
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 10,330
  8. Avatar for Czech National Team 8. Czech National Team 11 pts. 10,136
  9. Avatar for METU-BIN 9. METU-BIN 7 pts. 10,078
  10. Avatar for BOINC@Poland 10. BOINC@Poland 5 pts. 10,072

  1. Avatar for Mohoernchen 101. Mohoernchen Lv 1 1 pt. 9,504
  2. Avatar for zo3xiaJonWeinberg 102. zo3xiaJonWeinberg Lv 1 1 pt. 9,501
  3. Avatar for rinze 103. rinze Lv 1 1 pt. 9,463
  4. Avatar for martinf 104. martinf Lv 1 1 pt. 9,439
  5. Avatar for donuts554 105. donuts554 Lv 1 1 pt. 9,438
  6. Avatar for zannipietro 106. zannipietro Lv 1 1 pt. 9,430
  7. Avatar for ManVsYard 107. ManVsYard Lv 1 1 pt. 9,417
  8. Avatar for harvardman 108. harvardman Lv 1 1 pt. 9,384
  9. Avatar for milkshake 109. milkshake Lv 1 1 pt. 9,377
  10. Avatar for roman madala 110. roman madala Lv 1 1 pt. 9,316

Comments