Placeholder image of a protein
Icon representing a puzzle

2004: Revisiting Puzzle 67: Integrase

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
June 10, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,529
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,503
  3. Avatar for Contenders 3. Contenders 58 pts. 10,456
  4. Avatar for Go Science 4. Go Science 43 pts. 10,441
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 10,373
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 10,335
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 10,330
  8. Avatar for Czech National Team 8. Czech National Team 11 pts. 10,136
  9. Avatar for METU-BIN 9. METU-BIN 7 pts. 10,078
  10. Avatar for BOINC@Poland 10. BOINC@Poland 5 pts. 10,072
  1. Avatar for pfirth 91. pfirth Lv 1 1 pt. 9,624
  2. Avatar for dahast.de 92. dahast.de Lv 1 1 pt. 9,622
  3. Avatar for pascal ochem 93. pascal ochem Lv 1 1 pt. 9,621
  4. Avatar for fishercat 94. fishercat Lv 1 1 pt. 9,608
  5. Avatar for Hellcat6 95. Hellcat6 Lv 1 1 pt. 9,590
  6. Avatar for ivalnic 96. ivalnic Lv 1 1 pt. 9,588
  7. Avatar for SHK5P 97. SHK5P Lv 1 1 pt. 9,585
  8. Avatar for AlkiP0Ps 98. AlkiP0Ps Lv 1 1 pt. 9,542
  9. Avatar for Squirrely 99. Squirrely Lv 1 1 pt. 9,533
  10. Avatar for molleke 100. molleke Lv 1 1 pt. 9,512

Comments