Placeholder image of a protein
Icon representing a puzzle

2004: Revisiting Puzzle 67: Integrase

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
June 10, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,529
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,503
  3. Avatar for Contenders 3. Contenders 58 pts. 10,456
  4. Avatar for Go Science 4. Go Science 43 pts. 10,441
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 10,373
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 10,335
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 10,330
  8. Avatar for Czech National Team 8. Czech National Team 11 pts. 10,136
  9. Avatar for METU-BIN 9. METU-BIN 7 pts. 10,078
  10. Avatar for BOINC@Poland 10. BOINC@Poland 5 pts. 10,072
  1. Avatar for robgee 11. robgee Lv 1 70 pts. 10,376
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 67 pts. 10,365
  3. Avatar for WBarme1234 13. WBarme1234 Lv 1 65 pts. 10,344
  4. Avatar for Lotus23 14. Lotus23 Lv 1 62 pts. 10,337
  5. Avatar for guineapig 15. guineapig Lv 1 60 pts. 10,336
  6. Avatar for g_b 16. g_b Lv 1 57 pts. 10,335
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 55 pts. 10,335
  8. Avatar for jobo0502 18. jobo0502 Lv 1 53 pts. 10,332
  9. Avatar for sallallami 19. sallallami Lv 1 51 pts. 10,331
  10. Avatar for Skippysk8s 20. Skippysk8s Lv 1 49 pts. 10,330

Comments