Placeholder image of a protein
Icon representing a puzzle

2016: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,957
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,950
  3. Avatar for Go Science 3. Go Science 47 pts. 10,945
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 10,724
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,715
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,601
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 10,520
  8. Avatar for Contenders 8. Contenders 4 pts. 10,419
  9. Avatar for Australia 9. Australia 2 pts. 10,325
  10. Avatar for Team China 10. Team China 1 pt. 10,176
  1. Avatar for Oransche 71. Oransche Lv 1 2 pts. 10,141
  2. Avatar for Merf 72. Merf Lv 1 2 pts. 10,141
  3. Avatar for Todd6485577 73. Todd6485577 Lv 1 2 pts. 10,134
  4. Avatar for Teecho 74. Teecho Lv 1 2 pts. 10,130
  5. Avatar for stomjoh 75. stomjoh Lv 1 2 pts. 10,129
  6. Avatar for boninvi 76. boninvi Lv 1 2 pts. 10,115
  7. Avatar for ProfVince 77. ProfVince Lv 1 2 pts. 10,115
  8. Avatar for ManVsYard 78. ManVsYard Lv 1 2 pts. 10,114
  9. Avatar for Hellcat6 79. Hellcat6 Lv 1 1 pt. 10,102
  10. Avatar for infjamc 80. infjamc Lv 1 1 pt. 10,101

Comments