Placeholder image of a protein
Icon representing a puzzle

2016: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,957
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,950
  3. Avatar for Go Science 3. Go Science 47 pts. 10,945
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 10,724
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,715
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,601
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 10,520
  8. Avatar for Contenders 8. Contenders 4 pts. 10,419
  9. Avatar for Australia 9. Australia 2 pts. 10,325
  10. Avatar for Team China 10. Team China 1 pt. 10,176
  1. Avatar for johnmitch 11. johnmitch Lv 1 67 pts. 10,754
  2. Avatar for robgee 12. robgee Lv 1 64 pts. 10,730
  3. Avatar for fiendish_ghoul 13. fiendish_ghoul Lv 1 62 pts. 10,726
  4. Avatar for christioanchauvin 14. christioanchauvin Lv 1 59 pts. 10,724
  5. Avatar for guineapig 15. guineapig Lv 1 57 pts. 10,718
  6. Avatar for Deleted player 16. Deleted player pts. 10,713
  7. Avatar for frood66 17. frood66 Lv 1 52 pts. 10,710
  8. Avatar for drjr 18. drjr Lv 1 50 pts. 10,702
  9. Avatar for NinjaGreg 19. NinjaGreg Lv 1 47 pts. 10,700
  10. Avatar for toshiue 20. toshiue Lv 1 45 pts. 10,689

Comments