Placeholder image of a protein
Icon representing a puzzle

2016: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,957
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,950
  3. Avatar for Go Science 3. Go Science 47 pts. 10,945
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 10,724
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,715
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,601
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 10,520
  8. Avatar for Contenders 8. Contenders 4 pts. 10,419
  9. Avatar for Australia 9. Australia 2 pts. 10,325
  10. Avatar for Team China 10. Team China 1 pt. 10,176
  1. Avatar for Simek 31. Simek Lv 1 27 pts. 10,520
  2. Avatar for Maerlyn138 32. Maerlyn138 Lv 1 25 pts. 10,512
  3. Avatar for jausmh 33. jausmh Lv 1 24 pts. 10,489
  4. Avatar for alcor29 34. alcor29 Lv 1 23 pts. 10,488
  5. Avatar for fishercat 35. fishercat Lv 1 22 pts. 10,473
  6. Avatar for WBarme1234 36. WBarme1234 Lv 1 21 pts. 10,458
  7. Avatar for Deleted player 37. Deleted player 20 pts. 10,439
  8. Avatar for Visok 38. Visok Lv 1 19 pts. 10,431
  9. Avatar for Norrjane 39. Norrjane Lv 1 18 pts. 10,430
  10. Avatar for NeLikomSheet 40. NeLikomSheet Lv 1 17 pts. 10,428

Comments