Placeholder image of a protein
Icon representing a puzzle

2016: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,957
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,950
  3. Avatar for Go Science 3. Go Science 47 pts. 10,945
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 10,724
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,715
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,601
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 10,520
  8. Avatar for Contenders 8. Contenders 4 pts. 10,419
  9. Avatar for Australia 9. Australia 2 pts. 10,325
  10. Avatar for Team China 10. Team China 1 pt. 10,176
  1. Avatar for zippyc137 51. zippyc137 Lv 1 9 pts. 10,308
  2. Avatar for Evica 52. Evica Lv 1 8 pts. 10,302
  3. Avatar for tracybutt 53. tracybutt Lv 1 8 pts. 10,278
  4. Avatar for nicobul 54. nicobul Lv 1 7 pts. 10,275
  5. Avatar for manu8170 55. manu8170 Lv 1 7 pts. 10,270
  6. Avatar for Wiz kid 56. Wiz kid Lv 1 7 pts. 10,269
  7. Avatar for fpc 57. fpc Lv 1 6 pts. 10,269
  8. Avatar for heather-1 58. heather-1 Lv 1 6 pts. 10,249
  9. Avatar for bamh 59. bamh Lv 1 5 pts. 10,246
  10. Avatar for kyoota 60. kyoota Lv 1 5 pts. 10,236

Comments