Placeholder image of a protein
Icon representing a puzzle

2025: Revisiting Puzzle 73: Polycystein

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
July 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Go Science 100 pts. 10,752
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,722
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,696
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,502
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,356
  6. Avatar for Contenders 6. Contenders 18 pts. 10,321
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,215
  8. Avatar for BOINC@Poland 8. BOINC@Poland 8 pts. 10,079
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,796
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,461

  1. Avatar for prooh 101. prooh Lv 1 1 pt. 9,035
  2. Avatar for mwm64 102. mwm64 Lv 1 1 pt. 9,026
  3. Avatar for fillament 103. fillament Lv 1 1 pt. 8,994
  4. Avatar for Squirrely 104. Squirrely Lv 1 1 pt. 8,975
  5. Avatar for pfirth 105. pfirth Lv 1 1 pt. 8,920
  6. Avatar for MrZanav 106. MrZanav Lv 1 1 pt. 8,801
  7. Avatar for kitsoune 107. kitsoune Lv 1 1 pt. 8,759
  8. Avatar for misterben64 108. misterben64 Lv 1 1 pt. 8,675
  9. Avatar for alyssa_d_V2.0 109. alyssa_d_V2.0 Lv 1 1 pt. 8,659
  10. Avatar for kevin everington 110. kevin everington Lv 1 1 pt. 8,634

Comments