Placeholder image of a protein
Icon representing a puzzle

2036: Revisiting Puzzle 77: Copper Chaperone

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
August 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,366
  2. Avatar for chem2523 assignment 12. chem2523 assignment 1 pt. 8,973
  3. Avatar for Russian team 13. Russian team 1 pt. 8,953
  4. Avatar for Team China 14. Team China 1 pt. 8,387
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,685
  6. Avatar for Window Group 16. Window Group 1 pt. 7,646
  7. Avatar for IBS BCS 17. IBS BCS 1 pt. 6,482

  1. Avatar for karenh 121. karenh Lv 1 1 pt. 8,853
  2. Avatar for ksun3050 122. ksun3050 Lv 1 1 pt. 8,849
  3. Avatar for ebak 123. ebak Lv 1 1 pt. 8,834
  4. Avatar for nn1234 124. nn1234 Lv 1 1 pt. 8,817
  5. Avatar for Mohoernchen 125. Mohoernchen Lv 1 1 pt. 8,761
  6. Avatar for slee7444 126. slee7444 Lv 1 1 pt. 8,726
  7. Avatar for antheaford 127. antheaford Lv 1 1 pt. 8,712
  8. Avatar for sris6938 128. sris6938 Lv 1 1 pt. 8,707
  9. Avatar for jeremyhely 129. jeremyhely Lv 1 1 pt. 8,697
  10. Avatar for KatiaJMR 130. KatiaJMR Lv 1 1 pt. 8,665

Comments