Placeholder image of a protein
Icon representing a puzzle

2036: Revisiting Puzzle 77: Copper Chaperone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,384
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,381
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 10,184
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 36 pts. 10,103
  5. Avatar for Contenders 5. Contenders 24 pts. 10,072
  6. Avatar for Go Science 6. Go Science 16 pts. 10,071
  7. Avatar for SETI.Germany 7. SETI.Germany 10 pts. 9,613
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,595
  9. Avatar for Australia 9. Australia 4 pts. 9,429
  10. Avatar for Gargleblasters 10. Gargleblasters 2 pts. 9,416
  1. Avatar for karenh 121. karenh Lv 1 1 pt. 8,853
  2. Avatar for ksun3050 122. ksun3050 Lv 1 1 pt. 8,849
  3. Avatar for ebak 123. ebak Lv 1 1 pt. 8,834
  4. Avatar for nn1234 124. nn1234 Lv 1 1 pt. 8,817
  5. Avatar for Mohoernchen 125. Mohoernchen Lv 1 1 pt. 8,761
  6. Avatar for slee7444 126. slee7444 Lv 1 1 pt. 8,726
  7. Avatar for antheaford 127. antheaford Lv 1 1 pt. 8,712
  8. Avatar for sris6938 128. sris6938 Lv 1 1 pt. 8,707
  9. Avatar for jeremyhely 129. jeremyhely Lv 1 1 pt. 8,697
  10. Avatar for KatiaJMR 130. KatiaJMR Lv 1 1 pt. 8,665

Comments