Placeholder image of a protein
Icon representing a puzzle

2036: Revisiting Puzzle 77: Copper Chaperone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,366
  2. Avatar for chem2523 assignment 12. chem2523 assignment 1 pt. 8,973
  3. Avatar for Russian team 13. Russian team 1 pt. 8,953
  4. Avatar for Team China 14. Team China 1 pt. 8,387
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,685
  6. Avatar for Window Group 16. Window Group 1 pt. 7,646
  7. Avatar for IBS BCS 17. IBS BCS 1 pt. 6,482
  1. Avatar for Galims 151. Galims Lv 1 1 pt. 8,372
  2. Avatar for Slop2993 152. Slop2993 Lv 1 1 pt. 8,329
  3. Avatar for lhol9154 153. lhol9154 Lv 1 1 pt. 8,321
  4. Avatar for ldav4509 154. ldav4509 Lv 1 1 pt. 8,225
  5. Avatar for ingo6532 155. ingo6532 Lv 1 1 pt. 8,072
  6. Avatar for sogr2286 156. sogr2286 Lv 1 1 pt. 8,032
  7. Avatar for hdao5494 157. hdao5494 Lv 1 1 pt. 7,996
  8. Avatar for BurgundyClouds 158. BurgundyClouds Lv 1 1 pt. 7,879
  9. Avatar for harvardman 159. harvardman Lv 1 1 pt. 7,691
  10. Avatar for joshmiller 160. joshmiller Lv 1 1 pt. 7,685

Comments