Placeholder image of a protein
Icon representing a puzzle

2036: Revisiting Puzzle 77: Copper Chaperone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,384
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,381
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 10,184
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 36 pts. 10,103
  5. Avatar for Contenders 5. Contenders 24 pts. 10,072
  6. Avatar for Go Science 6. Go Science 16 pts. 10,071
  7. Avatar for SETI.Germany 7. SETI.Germany 10 pts. 9,613
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,595
  9. Avatar for Australia 9. Australia 4 pts. 9,429
  10. Avatar for Gargleblasters 10. Gargleblasters 2 pts. 9,416
  1. Avatar for Galims 151. Galims Lv 1 1 pt. 8,372
  2. Avatar for Slop2993 152. Slop2993 Lv 1 1 pt. 8,329
  3. Avatar for lhol9154 153. lhol9154 Lv 1 1 pt. 8,321
  4. Avatar for ldav4509 154. ldav4509 Lv 1 1 pt. 8,225
  5. Avatar for ingo6532 155. ingo6532 Lv 1 1 pt. 8,072
  6. Avatar for sogr2286 156. sogr2286 Lv 1 1 pt. 8,032
  7. Avatar for hdao5494 157. hdao5494 Lv 1 1 pt. 7,996
  8. Avatar for BurgundyClouds 158. BurgundyClouds Lv 1 1 pt. 7,879
  9. Avatar for harvardman 159. harvardman Lv 1 1 pt. 7,691
  10. Avatar for joshmiller 160. joshmiller Lv 1 1 pt. 7,685

Comments