Placeholder image of a protein
Icon representing a puzzle

2036: Revisiting Puzzle 77: Copper Chaperone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,384
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,381
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 10,184
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 36 pts. 10,103
  5. Avatar for Contenders 5. Contenders 24 pts. 10,072
  6. Avatar for Go Science 6. Go Science 16 pts. 10,071
  7. Avatar for SETI.Germany 7. SETI.Germany 10 pts. 9,613
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,595
  9. Avatar for Australia 9. Australia 4 pts. 9,429
  10. Avatar for Gargleblasters 10. Gargleblasters 2 pts. 9,416
  1. Avatar for jflat06 161. jflat06 Lv 1 1 pt. 7,646
  2. Avatar for Harry Hu 162. Harry Hu Lv 1 1 pt. 7,160
  3. Avatar for philyou 163. philyou Lv 1 1 pt. 6,644
  4. Avatar for beaeusebio 164. beaeusebio Lv 1 1 pt. 6,559
  5. Avatar for flippflopp2000 165. flippflopp2000 Lv 1 1 pt. 6,545
  6. Avatar for ElAjoloteNegro 166. ElAjoloteNegro Lv 1 1 pt. 6,533
  7. Avatar for alejandroft99 167. alejandroft99 Lv 1 1 pt. 6,529
  8. Avatar for Juan David Bautista 168. Juan David Bautista Lv 1 1 pt. 6,528
  9. Avatar for McJoey 169. McJoey Lv 1 1 pt. 6,523
  10. Avatar for plwalters19 170. plwalters19 Lv 1 1 pt. 6,482

Comments