Placeholder image of a protein
Icon representing a puzzle

2042: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,735
  2. Avatar for Go Science 2. Go Science 74 pts. 10,728
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,661
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,614
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,607
  6. Avatar for Contenders 6. Contenders 18 pts. 10,595
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,574
  8. Avatar for AlphaFold 8. AlphaFold 8 pts. 10,552
  9. Avatar for Kotocycle 9. Kotocycle 5 pts. 10,190
  10. Avatar for Czech National Team 10. Czech National Team 3 pts. 10,122
  1. Avatar for Deet 101. Deet Lv 1 1 pt. 9,752
  2. Avatar for mwm64 102. mwm64 Lv 1 1 pt. 9,737
  3. Avatar for rinze 103. rinze Lv 1 1 pt. 9,662
  4. Avatar for MrZanav 104. MrZanav Lv 1 1 pt. 9,653
  5. Avatar for jawz101 105. jawz101 Lv 1 1 pt. 9,605
  6. Avatar for cjddig 106. cjddig Lv 1 1 pt. 9,558
  7. Avatar for WeenScoped 107. WeenScoped Lv 1 1 pt. 9,479
  8. Avatar for sneebs 108. sneebs Lv 1 1 pt. 9,399
  9. Avatar for kolagris 109. kolagris Lv 1 1 pt. 9,364
  10. Avatar for ayashka12 110. ayashka12 Lv 1 1 pt. 9,361

Comments