Placeholder image of a protein
Icon representing a puzzle

2042: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,735
  2. Avatar for Go Science 2. Go Science 74 pts. 10,728
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,661
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,614
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,607
  6. Avatar for Contenders 6. Contenders 18 pts. 10,595
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,574
  8. Avatar for AlphaFold 8. AlphaFold 8 pts. 10,552
  9. Avatar for Kotocycle 9. Kotocycle 5 pts. 10,190
  10. Avatar for Czech National Team 10. Czech National Team 3 pts. 10,122

  1. Avatar for eweber 131. eweber Lv 1 1 pt. 8,953
  2. Avatar for furi0us 132. furi0us Lv 1 1 pt. 8,888
  3. Avatar for kvasirthewise 133. kvasirthewise Lv 1 1 pt. 8,871
  4. Avatar for alexandrabryan 134. alexandrabryan Lv 1 1 pt. 8,863
  5. Avatar for kokichi6522 135. kokichi6522 Lv 1 1 pt. 8,641
  6. Avatar for minifern 136. minifern Lv 1 1 pt. 8,610
  7. Avatar for milkshake 137. milkshake Lv 1 1 pt. 8,600
  8. Avatar for jccassella 138. jccassella Lv 1 1 pt. 8,547
  9. Avatar for lickington 139. lickington Lv 1 1 pt. 8,425
  10. Avatar for headlook 140. headlook Lv 1 1 pt. 8,349

Comments