Placeholder image of a protein
Icon representing a puzzle

2048: Revisiting Puzzle 83: Cardiotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,428
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 10,376
  3. Avatar for Go Science 3. Go Science 56 pts. 10,336
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 10,316
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 10,218
  6. Avatar for Contenders 6. Contenders 20 pts. 10,140
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 10,105
  8. Avatar for Australia 8. Australia 9 pts. 9,260
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,069
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 8,932
  1. Avatar for cbwest 101. cbwest Lv 1 1 pt. 7,648
  2. Avatar for Stromkarls Zheng 102. Stromkarls Zheng Lv 1 1 pt. 7,588
  3. Avatar for sed4906 103. sed4906 Lv 1 1 pt. 7,481
  4. Avatar for slamdunkin 104. slamdunkin Lv 1 1 pt. 7,388
  5. Avatar for kevin everington 105. kevin everington Lv 1 1 pt. 7,385
  6. Avatar for Kimbostu 106. Kimbostu Lv 1 1 pt. 7,319
  7. Avatar for furi0us 107. furi0us Lv 1 1 pt. 7,296
  8. Avatar for Marco0111 108. Marco0111 Lv 1 1 pt. 7,290
  9. Avatar for andresesuarezj 109. andresesuarezj Lv 1 1 pt. 7,276
  10. Avatar for Paradap 110. Paradap Lv 1 1 pt. 7,204

Comments