Placeholder image of a protein
Icon representing a puzzle

2089: Revisiting Puzzle 96: Collagen

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
December 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Australia 11. Australia 2 pts. 9,171
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 8,967
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 8,883
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,777
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 8,374
  6. Avatar for Protein structural analysis room Japan 16. Protein structural analysis room Japan 1 pt. 8,186
  7. Avatar for Wright Biology SBI4U 17. Wright Biology SBI4U 1 pt. 5,857
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 3,129
  1. Avatar for okaits7534 111. okaits7534 Lv 1 1 pt. 8,186
  2. Avatar for franklin99 112. franklin99 Lv 1 1 pt. 8,176
  3. Avatar for krzycho7 113. krzycho7 Lv 1 1 pt. 8,173
  4. Avatar for Antoinette Nguyen 114. Antoinette Nguyen Lv 1 1 pt. 8,165
  5. Avatar for RULIGAMER123 115. RULIGAMER123 Lv 1 1 pt. 8,164
  6. Avatar for furi0us 116. furi0us Lv 1 1 pt. 8,116
  7. Avatar for ManVsYard 117. ManVsYard Lv 1 1 pt. 8,114
  8. Avatar for froschi2 118. froschi2 Lv 1 1 pt. 8,113
  9. Avatar for drumpeter18yrs9yrs 119. drumpeter18yrs9yrs Lv 1 1 pt. 8,093
  10. Avatar for Pinx 120. Pinx Lv 1 1 pt. 8,087

Comments